Total number of results for Oryzias latipes are 13
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP01557 |
ESVLHQPQRF
|
10 | Oryzias latipes | FMRFamide related peptide | Neuropeptide FF | 19118555#Suehiro Y, Yasuda A, Okuyama T, Imada H, Kuroyanagi Y, Kubo T, Takeuchi H#Mass spectrometric map of neuropeptide expression and analysis of the gamma-prepro-tachykinin gene expression in the medaka (Oryzias latipes) brain#Gen Comp Endocrinol 2009 Mar;161(1):138-45 | |
| NP02901 |
TADDNNQVLEHRNLAQQLNIPIL
|
23 | Oryzias latipes | Melanin-concentrating hormone | MCH gene-related peptide | 19118555#Suehiro Y, Yasuda A, Okuyama T, Imada H, Kuroyanagi Y, Kubo T, Takeuchi H#Mass spectrometric map of neuropeptide expression and analysis of the gamma-prepro-tachykinin gene expression in the medaka (Oryzias latipes) brain#Gen Comp Endocrinol 2009 Mar;161(1):138-45 | |
| NP02902 |
DTMRCMVGRVYRPCWEV
|
17 | Oryzias latipes | Melanin-concentrating hormone | Melanin-concentrating hormone | 19118555#Suehiro Y, Yasuda A, Okuyama T, Imada H, Kuroyanagi Y, Kubo T, Takeuchi H#Mass spectrometric map of neuropeptide expression and analysis of the gamma-prepro-tachykinin gene expression in the medaka (Oryzias latipes) brain#Gen Comp Endocrinol 2009 Mar;161(1):138-45 | |
| NP03647 |
GGSTSRSGCFGHKMDRIGTISGMGC
|
25 | Oryzias latipes | Natriuretic peptide | C-type natriuretic peptide 4 | ||
| NP04079 |
SYSMEHFRWGKPV
|
13 | Oryzias latipes | Opioid | Alpha-melanocyte-stimulating hormone | 19118555#Suehiro Y, Yasuda A, Okuyama T, Imada H, Kuroyanagi Y, Kubo T, Takeuchi H#Mass spectrometric map of neuropeptide expression and analysis of the gamma-prepro-tachykinin gene expression in the medaka (Oryzias latipes) brain#Gen Comp Endocrinol 2009 Mar;161(1):138-45 | |
| NP04080 |
RPVKVYTPNGVEEESSEVFPGEM
|
23 | Oryzias latipes | Opioid | Corticotropin-like intermediate lobe peptide | 19118555#Suehiro Y, Yasuda A, Okuyama T, Imada H, Kuroyanagi Y, Kubo T, Takeuchi H#Mass spectrometric map of neuropeptide expression and analysis of the gamma-prepro-tachykinin gene expression in the medaka (Oryzias latipes) brain#Gen Comp Endocrinol 2009 Mar;161(1):138-45 | |
| NP04081 |
DGSYKMKHFRWSGPPAS
|
17 | Oryzias latipes | Opioid | β- melanocyte-stimulating hormone | 19118555#Suehiro Y, Yasuda A, Okuyama T, Imada H, Kuroyanagi Y, Kubo T, Takeuchi H#Mass spectrometric map of neuropeptide expression and analysis of the gamma-prepro-tachykinin gene expression in the medaka (Oryzias latipes) brain#Gen Comp Endocrinol 2009 Mar;161(1):138-45 | |
| NP04082 |
YGGFMKSWEEDRQKPLVTLFKNIINKDEQQ
|
30 | Oryzias latipes | Opioid | β-Endorphin | 19118555#Suehiro Y, Yasuda A, Okuyama T, Imada H, Kuroyanagi Y, Kubo T, Takeuchi H#Mass spectrometric map of neuropeptide expression and analysis of the gamma-prepro-tachykinin gene expression in the medaka (Oryzias latipes) brain#Gen Comp Endocrinol 2009 Mar;161(1):138-45 | |
| NP05376 |
AGCKNFFWKTFTSC
|
14 | Oryzias latipes | Somastostatin | Somatostatin-1 | 19118555#Suehiro Y, Yasuda A, Okuyama T, Imada H, Kuroyanagi Y, Kubo T, Takeuchi H#Mass spectrometric map of neuropeptide expression and analysis of the gamma-prepro-tachykinin gene expression in the medaka (Oryzias latipes) brain#Gen Comp Endocrinol 2009 Mar;161(1):138-45 | |
| NP05377 |
AGCRNFFWKTFTSC
|
14 | Oryzias latipes | Somastostatin | Somatostatin-2 | 19118555#Suehiro Y, Yasuda A, Okuyama T, Imada H, Kuroyanagi Y, Kubo T, Takeuchi H#Mass spectrometric map of neuropeptide expression and analysis of the gamma-prepro-tachykinin gene expression in the medaka (Oryzias latipes) brain#Gen Comp Endocrinol 2009 Mar;161(1):138-45 | |
| NP05485 |
LDCRDDQASLARCPSISQEKLLDRVIHHAELIYRVSEESCSLFEEMFIPLPLRLQSNQGGYACITKALPIPSSKSEIQQLSDKWLLHSVLMLVQSWIEPLVYLQMTLDRYDHAPDMLLNKTKWVSEKLISLEQGVVVLIKKMLDEGAMTTTYSEQGAFQYDVQLEMLEYVMRDYTLLTCLKKDAHKMETFLKLLKCRQTDKYNCA
|
205 | Oryzias latipes | Somatotropin/prolactin | Somatolactin | ||
| NP05597 |
KPRPHQFIGLM
|
11 | Oryzias latipes | Tachykinin | Substance P | 19118555#Suehiro Y, Yasuda A, Okuyama T, Imada H, Kuroyanagi Y, Kubo T, Takeuchi H#Mass spectrometric map of neuropeptide expression and analysis of the gamma-prepro-tachykinin gene expression in the medaka (Oryzias latipes) brain#Gen Comp Endocrinol 2009 Mar;161(1):138-45 | |
| NP05823 |
CYIQNCPRG
|
9 | Oryzias latipes | Vasopressin/oxytocin | Arg-vasotocin | 19118555#Suehiro Y, Yasuda A, Okuyama T, Imada H, Kuroyanagi Y, Kubo T, Takeuchi H#Mass spectrometric map of neuropeptide expression and analysis of the gamma-prepro-tachykinin gene expression in the medaka (Oryzias latipes) brain#Gen Comp Endocrinol 2009 Mar;161(1):138-45 |